Design in Proteins
by MikeGeneRecently, I discovered that design does indeed exist in the evolution protein known as RecA. The gene that codes for this particular protein is found here, residing in the genome of Campylobacter hominis.
If you look closely at part of the amino acid sequence (where the 20 different amino acids are represented by 20 different letters), you'll find this sequence:
lkqndesignrakvkvvknk
Look more closely:
lkqndesignrakvkvvknk
As you can clearly see, design is indeed in this protein!
That raises the question of whether the designer had something else for this investigator. And, oh boy, check out "hypothetical" (wink, wink) protein NY2A_B842R (from the Paramecium bursaria Chlorella virus NY2A)
mvnpvsiqsqldqlnskfdaaikeidthinkiytrldkms seieeaksdl etiyksflrqekapsvtsir q
Okay designer, you got my attention. And what's this? Sequence from an integral membrane protein from Clostridium:
vvicivgiimikegiene
Great!
Message to the designer:
It's MikeGene, not MikeGiene!!
October 1st, 2007 at 5:49 am
Not to worry, Mike. I'm sure the Designer knows how to spell your name. There must have been an insertion mutation after He encoded the message.
Humor aside, I've been waiting for someone to apply the Bible Code methodology to the human genome. It's inevitable.
Comment by keiths — October 1, 2007 @ 5:49 am
October 1st, 2007 at 1:16 pm
That's nothing. DARWIN appears in a wide variety of organisms, including viruses, bacteria, and plants, and slightly modified versions are even more widespread. BLAST flags it as a conserved motif.
NATSELEC is also a widespread conserved motif, though as befits a secret clue pointing towards evolution by natural selection, all the versions in GenBank are imperfect variants.
Comment by Nick — October 1, 2007 @ 1:16 pm
October 1st, 2007 at 11:20 pm
"DARWIN appears in a wide variety of organisms, including viruses, bacteria, and plants, and slightly modified versions are even more widespread. BLAST flags it as a conserved motif."
Sweet!
Comment by Eric Anderson — October 1, 2007 @ 11:20 pm
October 1st, 2007 at 11:33 pm
Hi Nick,
Yes, we Darwinists are pleased. But the same holds true for DESIGN. In fact, it's also part of many chaperonins, protein complexes known to facilitate folding.
Comment by MikeGene — October 1, 2007 @ 11:33 pm