Telic Thoughts is an independent blog about intelligent design.


« Dwindling Diversity
Dawkins Misuses Science »

Design in Proteins

by MikeGene

Recently, I discovered that design does indeed exist in the evolution protein known as RecA. The gene that codes for this particular protein is found here, residing in the genome of Campylobacter hominis.

If you look closely at part of the amino acid sequence (where the 20 different amino acids are represented by 20 different letters), you'll find this sequence:

lkqndesignrakvkvvknk

Look more closely:

lkqndesignrakvkvvknk

As you can clearly see, design is indeed in this protein!

That raises the question of whether the designer had something else for this investigator. And, oh boy, check out "hypothetical" (wink, wink) protein NY2A_B842R (from the Paramecium bursaria Chlorella virus NY2A)

mvnpvsiqsqldqlnskfdaaikeidthinkiytrldkms seieeaksdl etiyksflrqekapsvtsir q

Okay designer, you got my attention. And what's this? Sequence from an integral membrane protein from Clostridium:

vvicivgiimikegiene

Great!

Message to the designer:

It's MikeGene, not MikeGiene!!

This entry was posted on Sunday, September 30th, 2007 at 10:44 pm and is filed under Humor, Intelligent Design. You can follow any responses to this entry through the RSS 2.0 feed. Both comments and pings are currently closed.

4 Responses to “Design in Proteins”

  1. keiths Says:
    October 1st, 2007 at 5:49 am

    Message to the designer:

    It's MikeGene, not MikeGiene!!

    Not to worry, Mike. I'm sure the Designer knows how to spell your name. There must have been an insertion mutation after He encoded the message.

    Humor aside, I've been waiting for someone to apply the Bible Code methodology to the human genome. It's inevitable. :roll:

  2. Comment by keiths — October 1, 2007 @ 5:49 am

  3. Nick Says:
    October 1st, 2007 at 1:16 pm

    That's nothing. DARWIN appears in a wide variety of organisms, including viruses, bacteria, and plants, and slightly modified versions are even more widespread. BLAST flags it as a conserved motif.

    NATSELEC is also a widespread conserved motif, though as befits a secret clue pointing towards evolution by natural selection, all the versions in GenBank are imperfect variants.

  4. Comment by Nick — October 1, 2007 @ 1:16 pm

  5. Eric Anderson Says:
    October 1st, 2007 at 11:20 pm

    "DARWIN appears in a wide variety of organisms, including viruses, bacteria, and plants, and slightly modified versions are even more widespread. BLAST flags it as a conserved motif."

    Sweet!

  6. Comment by Eric Anderson — October 1, 2007 @ 11:20 pm

  7. MikeGene Says:
    October 1st, 2007 at 11:33 pm

    Hi Nick,

    That's nothing. DARWIN appears in a wide variety of organisms, including viruses, bacteria, and plants, and slightly modified versions are even more widespread. BLAST flags it as a conserved motif.

    Yes, we Darwinists are pleased. But the same holds true for DESIGN. In fact, it's also part of many chaperonins, protein complexes known to facilitate folding. :wink:

  8. Comment by MikeGene — October 1, 2007 @ 11:33 pm

  • Featured Books


    The Design Matrix: A Consilience of Clues by Mike Gene
    Your Inner Fish: A Journey into the 3.5-Billion-Year History of the Human Body

    Catalyzing Inquiry at the Interface of Computing and Biology

    System Modeling in Cellular Biology: From Concepts to Nuts and Bolts

    The Plausibility of Life By Marc W. Kirschner and John C. Gerhart

    Agents Under Fire by Angus Menuge

    Life's Solution by Simon Conway Morris

    Information Theory, Evolution and the Origin of Life by Hubert P. Yockey

    The Fifth Miracle by Paul Davies

    Nature, Design, and Science by Del Ratzsch

    Origination of Organismal Form by Muller & Newman

    Biased Embryos and Evolution by Wallace Arthur

    Rare Earth by Peter Ward and Donald Brownlee

    The Privileged Planet by Guillermo Gonzalez and Jay Richards

    The Way of the Cell by Franklin Harold

    The Volitional Brain by Benjamin Libet

    Evolution in Four Dimensions by Eva Jablonka & Marion Lamb

    The Evolution-Creation Struggle by Michael Ruse




Telic Thoughts is proudly powered by WordPress
Hosting provided by College Crunch.

Entries (RSS) and Comments (RSS).